General Information

  • ID:  hor000798
  • Uniprot ID:  Q26377
  • Protein name:  Corazonin 3-11
  • Gene name:  Crz
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  Corazonin family
  • Source:  animal
  • Expression:  From late embryo to larva, expression is consistently detected in three neuronal groups: dorso-lateral neurons (DL), dorso-medial neurons (DM), and neurons in the ventral nerve cord (vCrz). Both the vCrz and DM groups die via programmed cell death during
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0071858 corazonin receptor binding
  • GO BP:  GO:0006117 acetaldehyde metabolic process; GO:0007218 neuropeptide signaling pathway; GO:0007619 courtship behavior; GO:0045823 positive regulation of heart contraction; GO:0048149 behavioral response to ethanol; GO:0071361 cellular response to ethanol
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  FQYSRGWTN
  • Length:  9(22-30)
  • Propeptide:  MLRLLLLPLFLFTLSMCMGQTFQYSRGWTNGKRSFNAASPLLANGHLHRASELGLTDLYDLQDWSSDRRLERCLSQLQRSLIARNCVPGSDFNANRVDPDPENSAHPRLSNSNGENVLYSSANIPNRHRQSNELLEELSAAGGASAEPNVFGKH
  • Signal peptide:  MLRLLLLPLFLFTLSMCMG
  • Modification:  T9 Asparagine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Cardioactive peptide. Corazonin is probably involved in the physiological regulation of the heart beat. Clock (Clk) and cycle (cyc) proteins negatively regulate Crz transcription in a cell-specific manner.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  CrzR
  • Target Unid:  M9PF00
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q26377-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000798_AF2.pdbhor000798_ESM.pdb

Physical Information

Mass: 130110 Formula: C53H71N15O15
Absent amino acids: ACDEHIKLMPV Common amino acids: FGNQRSTWY
pI: 9.35 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 2
Hydrophobicity: -142.22 Boman Index: -2696
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 0
Instability Index: -721.11 Extinction Coefficient cystines: 6990
Absorbance 280nm: 873.75

Literature

  • PubMed ID:  16441518
  • Title:  Direct Mass Spectrometric Peptide Profiling and Fragmentation of Larval Peptide Hormone Release Sites in Drosophila Melanogaster Reveals Tagma-Specific Peptide Expression and Differential Processing